2-1-1-green-tea-extract-1

AMELX (Amelogenin (Amelogenesis Imperfecta 1, X-Linked), AIH1, ALGN, AMG, AMGL, AMGX) (MaxLight 650)

Product Details

Conjugate/Tag:	MaxLight650
Clonality:	Monoclonal
Clone Number:	6G3
Specificity:	Recognizes AMELX.
Host:	Mouse
Format:	Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Isotype:	IgG2b,k
Immunogen:	AMELX partial recombinant protein with GST tag. MW of the GST tag alone is 26 kD.
Immunogen Sequence:	PVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Purification:	Purified.
Application:	Western blot (WB).
Storage:	Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.

Get in Touch