2-1-1-green-tea-extract-1

AMELX (Amelogenin, X Isoform, AMG, AMGX) (MaxLight 405)

Product Details

Conjugate/Tag:	MaxLight405
Clonality:	Polyclonal
Specificity:	Recognizes human AMELX.
Species Reactivity:	Human
Host:	Rabbit
Format:	Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Isotype:	IgG
Immunogen:	Full length human AMELX, aa1-191.
Immunogen Sequence:	MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Purification:	Purified by protein A affinity chromatography.
Application:	Western blot (WB).
Storage:	Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.

Get in Touch