| Clonality: |
Polyclonal |
| Binding Specificity: |
AA 410-439 |
| Species Reactivity: |
Human |
| Host: |
Rabbit |
| Format: |
Lyophilized |
| Isotype: |
IgG |
| Immunogen: |
A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3(410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids. |
| Buffer: |
Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide. |
| Purification: |
Immunogen affinity purified. |
| Application: |
WB |
| Storage: |
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles. |
