| Source: |
Insect Cell |
| Molecular Weight: |
The protein has a calculated MW of 30.4 kDa, containing 276 amino acids. The protein migrates as 40-50 kDa in SDS-PAGE under reducing condition due to glycosylation. |
| AA Sequence: |
AGMGMSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGIEGRMDEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Purity: |
> 95% by SDS-PAGE analyses. |
| Physical Appearance: |
Sterile filtered white lyophilized (freeze-dried) powder. |
| Formulation: |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS. |
| Endotoxin: |
Less than 0.1 EU/μg of rHuCD24-Fc as determined by LAL method. |
| Reconstitution: |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions. |
| Stability & Storage: |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
12 months from date of receipt, -20 to -70°C as supplied.
1 month, 2 to 8°C under sterile conditions after reconstitution.
3 months, -20 to -70°C under sterile conditions after reconstitution. |
| Background: |
CD24, also known as Heat-Stable Antigen and Nectadrin, is a heavily glycosylated GPI-linked sialoprotein with a variable molecular weight of 30-60 kDa. In humans, CD24 is expressed on B lineage cells, granulocytes, epithelial, neuronal, and muscle cells, as well as various tumor cells. In mice, CD24 is even more broadly expressed, particularly in T cells, monocytes, and dendritic cells. Its expression is regulated during lineage development and cell activation.
Antibody crosslinking of CD24 enhances apoptosis in B and T lymphocytes, contributing to negative selection and immune tolerance. On antigen-presenting cells, CD24 works with B7 molecules to costimulate T cells. CD24 is also associated with Siglec-10 (or Siglec-G in mice) and with danger-associated molecules like HMGB1, HSP70, or HSP90, released from necrotic or damaged cells. These ternary complexes inhibit inflammatory responses by signaling through Siglec-10, counteracting extracellular DAMPs. Mature human CD24 shares 30% and 42% amino acid sequence identity with mouse and rat CD24, respectively. |
