| Source: |
Escherichia coli |
| Molecular Weight: |
Approximately 9.0 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids. |
| AA Sequence: |
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN |
| Purity: |
> 97% by SDS-PAGE analyses. |
| Physical Appearance: |
Sterile filtered white lyophilized (freeze-dried) powder. |
| Formulation: |
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH7.0, with 1 mM DTT, 5% trehalose. |
| Endotoxin: |
Less than 0.1 EU/μg of rHuCD59 as determined by LAL method. |
| Reconstitution: |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions. |
| Stability & Storage: |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
12 months from date of receipt, -20 to -70°C as supplied.
1 month, 2 to 8°C under sterile conditions after reconstitution.
3 months, -20 to -70°C under sterile conditions after reconstitution. |
| Background: |
CD59, also known as the membrane attack complex inhibition factor (MACIF) and Protectin, is an approximately 8.92kDa GPI‑anchored glycoprotein that regulates the complement system in blood. The complement system initiates innate immune responses through various pathways. One outcome is the formation of a membrane attack complex (MAC), which creates cytolytic pores in target cells. CD59 expressed widely in healthy cells, binds to C8 and C9, preventing complement‑mediated lysis. Its species‑selective binding restricts MACs from lysing cells of other species. CD59's cytoprotective role mitigates tissue damage and inflammation in ischemia/reperfusion injury, atherosclerosis, and abdominal aortic aneurysms. However, diabetes‑induced glycation can deactivate its protective function, leading to increased MAC deposition and hemolytic anemia. CD59 also serves as a cellular receptor for bacterial toxins and limits the destruction of virus particles. Additionally, it modulates T cell activation post interaction with antigen-presenting cells and promotes NK cell activation through association with NKp30 and NKp46. In mice, gene duplication has produced two related proteins, CD59a and CD59b. Mature human CD59 shares amino acid sequence identity with mouse CD59a, mouse CD59b, and rat CD59. |
